SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148828008|ref|YP_001292761.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148828008|ref|YP_001292761.1|
Domain Number 1 Region: 61-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.5e-79
Family L-arabinose binding protein-like 0.000067
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.84e-16
Family GalR/LacI-like bacterial regulator 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148828008|ref|YP_001292761.1|
Sequence length 333
Comment galactose operon repressor [Haemophilus influenzae PittGG]
Sequence
MSTIRDVAKLANVSVATVSRVLNHSISVSENTRLVVEQAIAQLYYQPNANAQALAVQNTD
TIGVVVTDVTDAFFAILVKAVDKVAEAHQKTILIGIGYHHAEKEREAINTLLRKRCSSLV
VHSKALSDDELSHYLNTVPGMVIINRVIKGYEHRCVSLDNQKGTYLATEMLIRYGHQHIA
YIGSNHAIFDEVERRNGYLAALKDHNYPIIEQAITLNTPDFEGGEKAMIDLLSYNKNLTA
VVAYNDSMAAGAISVLNENSISVPSQFSIVGFDDMPIARYLIPKLTTIRYPIDLMATYAA
KLALSLTDEKIITPPMVQFNPTLVRRFSVESKI
Download sequence
Identical sequences A0A0K9L5A0 A5UHX2
gi|543951558|ref|YP_008543632.1| 374931.CGSHiGG_07605 gi|148828008|ref|YP_001292761.1| WP_012055243.1.12387 WP_012055243.1.15927 WP_012055243.1.20644 WP_012055243.1.28719 WP_012055243.1.96396 WP_012055243.1.97818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]