SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148828098|ref|YP_001292851.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148828098|ref|YP_001292851.1|
Domain Number 1 Region: 5-226,416-668
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.21e-144
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000321
Further Details:      
 
Domain Number 2 Region: 226-415
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 3.98e-53
Family ValRS/IleRS/LeuRS editing domain 0.00000689
Further Details:      
 
Domain Number 3 Region: 662-860
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.66e-36
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148828098|ref|YP_001292851.1|
Sequence length 861
Comment leucyl-tRNA synthetase [Haemophilus influenzae PittGG]
Sequence
MQEQYRPDMIEPKVQQYWVENKVFKAIKDESKEKYYCLSMFPYPSGRLHMGHVRNYTIGD
VISRYQRMLGKNVLQPFGWDAFGLPAEGAAIKNKTAPAKWTYENIAYMKKQLQLLGFGFD
WDREIATCKPEYYKWEQWFFTELYKKGLVYKKTSTVNWCPNDETVLANEQVHEGCCWRCD
TPVEQKEIPQWFIKITDYAEQLLGGLDTLPQWPDMVKTMQRNWIGRSEGVEITFDVANTN
EKVAVYTTRPDTFYGVSYLGIAAAHPLASLAAQNNPELAAFIQEAKNAKVAEADLATMEK
KGMATGLFAIHPLTGEKLPIWVANFVLMHYGTGAVMAVPAHDQRDFEFAQKYSLPIKQVI
APLADEEIDLTKQAFVEHGKLVNSAEFDGKDFDGAFNGIADKLEKLGVGKRQVNYRLRDW
GVSRQRYWGAPIPMLTLENGDVVPAPMEDLPIILPEDVVMDGVKSPIKADPNWAKTTLNG
TPALKETDTFDTFMESSWYYARYTCPQYQNGMLDAEEANYWLPVDQYIGGIEHATMHLLY
FRFFHKLLRDAGFVTSEEPADKLLCQGMVLADAFYYTSPTNERIWVSPTQVTLERDEKGR
IIKATDPEGRELVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFASPAEMTLEWQE
SGVEGAKRFLGRVWNLVYQYQQNPAKTSLDITALSAEQKVLRREVHKTIAKVSDDIGRRQ
TFNTAIAAVMELMNKLTKAPLDSEQDRAVMAEALSAVVRMLYPITPHICFELWQALGNES
AIDTAEWVKADEAAMVEDEKLIVVQVNGKVRGKVTVAADADEDTVKTIAFADENVKKFID
NQHIVKVIYVVGKLLNVVVKP
Download sequence
Identical sequences A0A1Q5Y5X7 A5UI62
gi|148828098|ref|YP_001292851.1| 374931.CGSHiGG_08170 WP_012055298.1.45125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]