SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148828105|ref|YP_001292858.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148828105|ref|YP_001292858.1|
Domain Number 1 Region: 13-492
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 5.23e-214
Family Heme-dependent catalases 0.0000000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148828105|ref|YP_001292858.1|
Sequence length 508
Comment hypothetical protein CGSHiGG_08205 [Haemophilus influenzae PittGG]
Sequence
MSSQCPFSHLAATNLTMGNGAPVADNQNSLTAGPRGPLLAQDLWLNEKLADFVREVIPER
RMHAKGSGAFGTFTVTHDITKYTRAKIFSEVGKKTEMFARFTTVAGERGAADAERDIRGF
ALKFYTEEGNWDLVGNNTPVFFLRDPRKFPDLNKAVKRDPRTNMRSATNNWDFWTLLPEA
LHQVTVVMSDRGIPASYRHMHGFGSHTYSFWNEAGERFWVKFHFHTQQGIKNLTDAEAAA
VIANDRESHQRDLYEAIERGDFPKWTLFVQVMSEADAEKVPYHPFDLTKVWPKKDYPLIE
VGEFELNRNPENFFADVEQSAFAPSNLVPGIGASPDRMLQARLFNYADAQRYRLGVNYRQ
IPVNRPRCPVHSNQRDGQGRVDGNYGSLPHYEPNSFSQWQQQPDFAEPPLRINGDATHWD
YRNDDNDYFSQPRALFNLMNAEQKQALFNNTAAAMGDAPDFIKYRHIRNCHWCDAAYGEG
VAKALGLTVEDALKARDTDPALGQGGLL
Download sequence
Identical sequences A0A1Q5Y6H3 A5UI69
gi|148828105|ref|YP_001292858.1| 374931.CGSHiGG_08205 WP_012055303.1.45125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]