SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148828109|ref|YP_001292862.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148828109|ref|YP_001292862.1|
Domain Number 1 Region: 144-423
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.62e-125
Family Enolase 0.00000000103
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.53e-57
Family Enolase N-terminal domain-like 0.0000005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148828109|ref|YP_001292862.1|
Sequence length 436
Comment phosphopyruvate hydratase [Haemophilus influenzae PittGG]
Sequence
MAKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGLAAAPSGASTGSREALELRDGDKSRFL
GKGVLKAVAAVNNEIAQAIVGKDATNQAEIDQIMIDLDGTENKSNFGANAILAVSLANAK
AAAASKGLPLYAYIAELNGTAGVYSMPLPMMNIINGGEHADNNVDIQEFMIQPVGAKTLR
EALRIGAEVFHNLAKVLKAKGMSTAVGDEGGFAPNLASNADALACIKEAVEKAGYVLGKD
VTLAMDCASSEFYNKENGMYEMKGEGKSFTSQEFTHYLEELCKEYPIVSIEDGQDESDWE
GFAYQTKVLGDRVQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMA
KDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRIAKYNQLIRIEEALERA
GTPAAFPGLKAVKGQA
Download sequence
Identical sequences A0A0D0H0C7 A5UI73
WP_005693278.1.45125 WP_005693278.1.56181 WP_005693278.1.61635 WP_005693278.1.9694 gi|148828109|ref|YP_001292862.1| 374931.CGSHiGG_08225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]