SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148828139|ref|YP_001292892.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148828139|ref|YP_001292892.1|
Domain Number 1 Region: 3-203,404-649
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.43e-139
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000043
Further Details:      
 
Domain Number 2 Region: 653-931
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.06e-81
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00000689
Further Details:      
 
Domain Number 3 Region: 205-404
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 3.98e-57
Family ValRS/IleRS/LeuRS editing domain 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148828139|ref|YP_001292892.1|
Sequence length 941
Comment isoleucyl-tRNA synthetase [Haemophilus influenzae PittGG]
Sequence
MTVDYKNTLNLPETSFPMRGDLAKREPDMLKNWYEKNLYQKIRKASKGKKSFILHDGPPY
ANGNIHIGHAVNKILKDIIIKSKTALGFDSPYIPGWDCHGLPIELKVEGLVGKPNEKISA
AEFRQKCREYAAEQVEGQKKDFIRLGVLGDWDNPYLTMNFDTEANIIRTLGKVIENGHLY
KGSKPVHWCLDCGSSLAEAEVEYEDKVSPSIYVRFPAESADEIEAKFSAQGRGQGKLSAI
IWTTTPWTMPSNRAIAVNADLEYNLVQLGDERVILAAELVESVAKAVGIEHIEILGSVKG
DDLELSRFHHPFYDFTVPVILGDHVTTDGGTGLVHTAPDHGLDDFIVGKQYDLPMAGLVS
NDGKFISTTEFFAGKGVFEANPLVIEKLQEVGNLLKVEKIKHSYPHCWRHKTPIIFRATP
QWFIGMETQGLRQQALGEIKQVRWIPDWGQARIEKMVENRPDWCISRQRTWGVPMTLFVH
KETEELHPRTLDLLEEVAKRVERAGIQAWWDLDEKELLGADAETYRKVPDTLDVWFDSGS
TYSSVVANRPEFNGQNIDMYLEGSDQHRGWFMSSLMLSTATDSKAPYKQVLTHGFTVDGQ
GRKMSKSIGNIVTPQEVMDKFGGDILRLWVASTDYTGEMTVSDEILKRAADSYRRIRNTA
RFLLANLNGFDPKRDLVKPEEMVSLDRWAVACALDAQNEIKDAYDNYQFHTVVQRLMRFC
SVEMGSFYLDIIKDRQYTTKADSLARRSCQTALWHIAEALVRWMAPILSFTADEIWQHLP
QTESARAEFVFTEEFYQGLFGLGEDEKLDDAYWQQLIKVRSEVNRVLEISRNNKEIGGGL
EAEVTVYANDEYRALLAQLGNELRFVLITSKVDIKSLSEKPADLADSELEGIAVSVTRSN
AEKCPRCWHYSDEIGVSPEHPTLCARCVENVVGNGEVRHFA
Download sequence
Identical sequences A5UIA3
374931.CGSHiGG_08385 gi|148828139|ref|YP_001292892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]