SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148828147|ref|YP_001292900.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148828147|ref|YP_001292900.1|
Domain Number 1 Region: 109-316
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.65e-50
Family D-glucarate dehydratase-like 0.000000428
Further Details:      
 
Domain Number 2 Region: 5-104
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.48e-25
Family Enolase N-terminal domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148828147|ref|YP_001292900.1|
Sequence length 329
Comment O-succinylbenzoate synthase [Haemophilus influenzae PittGG]
Sequence
MAEKSFNLYRYSIPVDSQLILRDRFLKRREGLIVRVSCSRDGWGEIAPLPGFSEETLDQA
QEQAIEWLTTWCNASCDAPRVPLDGTYPSVAFGISCAMDEMKGYLQAEGNYHTAPLCYGD
PDELYAKLASMEGEKVAKMKVGIYEANRDGLIADMFLEAIPDLQLRLDANRHWSLEKALQ
FAAKVKPQHRKRIQFLEEPCKTQELSREFAAQTDIAIAWDESVREPNFCLEKEPHLSAIV
IKPTLIGSIQRCTELINQAHSLGLKAVISSSIESSLGLSQLARIAQQYTPNVTPGLDTLD
LMEYQVLRAWPSSDLPIVDLESEFITKII
Download sequence
Identical sequences A0A1Q5Y5T5 A5UIB1
gi|148828147|ref|YP_001292900.1| 374931.CGSHiGG_08425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]