SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148828361|ref|YP_001293114.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148828361|ref|YP_001293114.1|
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily Release factor 3.66e-115
Family Release factor 0.00000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148828361|ref|YP_001293114.1|
Sequence length 248
Comment peptide chain release factor 2 [Haemophilus influenzae PittGG]
Sequence
MFSGEHDACDCYVDLQAGSGGTEAQDWTEMLLRMYLRWAESKGFKTELMEVSDGDVAGLK
SATIKVSGEYAFGWLRTETGIHRLVRKSPFDSNNRRHTSFSAAFVYPEIDDDIDIEINPA
DLRIDVYRASGAGGQHVNKTESAVRITHMPSGIVVQCQNDRSQHKNKDQAMKQLKAKLYE
LELQKKNADKQAMEDNKSDIGWGSQIRSYVLDDSRIKDLRTGVENRNTQAVLDGDLDRFI
EASLKAGL
Download sequence
Identical sequences A0A0E1SNK1 A0A0H3PDK7 A0A0Y7IKD7 A4N553 A4NXZ6 A5UIX5 E7A560 F9GN04 H0KCN4
YP_008530236.1.63031 gi|148828361|ref|YP_001293114.1| gi|542123261|ref|YP_008530236.1| 374931.CGSHiGG_09785 gi|543951965|ref|YP_008544039.1| gi|319897322|ref|YP_004135518.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]