SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148828376|ref|YP_001293129.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148828376|ref|YP_001293129.1|
Domain Number 1 Region: 60-333
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.52e-92
Family L-arabinose binding protein-like 0.000000089
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.88e-16
Family GalR/LacI-like bacterial regulator 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148828376|ref|YP_001293129.1|
Sequence length 336
Comment DNA-binding transcriptional repressor PurR [Haemophilus influenzae PittGG]
Sequence
MATIKDVAKMAGVSTTTVSHVINKTRFVAKDTEEAVLSAIKQLNYSPSAVARSLKVNTTK
SIGMIVTTSEAPYFAEIIHSVEEHCYRQGYSLFLCNTQNDPEKVKNHLEMLAKKRVDGLL
VMCSEYTQDSLDLLSSFSTIPMVVMDWGPNANTDVIDDHSFDGGYLATKHLIECGHKKIG
IICGELNKTTARTRYEGFEKAMEEAKLTINPSWVLEGAFEPEDGYECMNRLLTQEELPTA
LFCCNDVMALGAISALTEKCLRVPEDMSIIGYDDIHASRFYAPPLTTIHQSKLRLGRQAV
NILLERITHKDEGVQQYSRIDITPELIIRKSVKSIL
Download sequence
Identical sequences A0A1Q5Y5J8 A5UIZ0
gi|148828376|ref|YP_001293129.1| 374931.CGSHiGG_09905 WP_012055471.1.45125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]