SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148828386|ref|YP_001293139.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148828386|ref|YP_001293139.1|
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.39e-32
Family DNA-binding N-terminal domain of transcription activators 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148828386|ref|YP_001293139.1|
Sequence length 135
Comment mercuric resistance operon regulatory protein [Haemophilus influenzae PittGG]
Sequence
MKIGALAKALGCTVETIRYYEQQGLIPPPKRTSGNFRQYNEEHLQRLSFICNCRNLDISL
SEIKSLLNLENTSKQQAEEINRVLDKHIKEVATRIHELAHLRMKLMELREKTVSNDEDPM
KLLLQHSGVKFVRLK
Download sequence
Identical sequences A0A1Q5Y5K7 A5UJ00
WP_012055477.1.45125 WP_012055477.1.79564 gi|148828386|ref|YP_001293139.1| 374931.CGSHiGG_09975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]