SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827610|ref|YP_001292363.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827610|ref|YP_001292363.1|
Domain Number 1 Region: 16-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.78e-54
Family Extended AAA-ATPase domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 261-317
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000167
Family FIS-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827610|ref|YP_001292363.1|
Sequence length 318
Comment transcriptional regulatory protein TyrR [Haemophilus influenzae PittGG]
Sequence
MTISKFNPQKPFECFIVQSEAMKSAVENAKRFAMFDVPLLIQGETGTGKDLLAKACHYQS
LRRDKKFIAVNCAGLPDEDAESEMFGRKVGDSETIGFFEYANEGTVLLDGIAELSLGLQA
KLLRFLTDGSFRRVGEEKEHYANVRVICTSQVPLHLLVEQGKVRADLFHRLNVLTLNVPP
LRERMTDIEPLAQGFLQEISEELKIAKPTFDKDFLLYLQKYDWKGNVRELYNTLYRACSL
VQDNHLTIESLNLAPPQSAVISLDEFGNKTLDEIIGSYEAQVLKLFYAEYPSTRKLAQRL
GVSHTAIANKLKQYGIGK
Download sequence
Identical sequences A5UGS4 Q4QND3
gi|68249012|ref|YP_248124.1| gi|148827610|ref|YP_001292363.1| WP_005686875.1.10621 WP_005686875.1.23920 WP_005686875.1.26667 WP_005686875.1.28397 WP_005686875.1.38938 WP_005686875.1.39279 WP_005686875.1.40343 WP_005686875.1.50588 WP_005686875.1.50795 WP_005686875.1.62697 WP_005686875.1.74240 WP_005686875.1.74810 WP_005686875.1.76410 WP_005686875.1.80605 WP_005686875.1.85244 WP_005686875.1.8829 WP_005686875.1.91188 WP_005686875.1.91647 WP_005686875.1.91769 WP_005686875.1.94621 WP_005686875.1.99776 281310.NTHI0534 374931.CGSHiGG_05235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]