SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110670563|ref|YP_667120.1| from Francisella tularensis subsp. tularensis FSC198

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110670563|ref|YP_667120.1|
Domain Number 1 Region: 198-394
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.63e-72
Family B3/B4 domain of PheRS, PheT 0.0000318
Further Details:      
 
Domain Number 2 Region: 42-196
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.37e-50
Family Myf domain 0.002
Further Details:      
 
Domain Number 3 Region: 470-687
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.83e-44
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00018
Further Details:      
 
Domain Number 4 Region: 693-789
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.66e-25
Family Anticodon-binding domain of PheRS 0.0016
Further Details:      
 
Domain Number 5 Region: 405-478
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 9.16e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110670563|ref|YP_667120.1|
Sequence length 790
Comment phenylalanyl-tRNA synthetase subunit beta [Francisella tularensis subsp. tularensis FSC198]
Sequence
MKFSHNWLNEYLGDTQDSQNLADTLTLAGLEVDAIEPVVAEKVSGVVVGQIKTINKHPDA
DKLNVCSVDAGEDELLTIVCGASNIYEGMKAPVAKIGAVLPGNFKIKKSKLRGQESFGMM
CSEEELGLAEKADGLMDLPIDAPVGTDINKYLNLDDNIIEVDLTPNRADCLSVYGIAREV
SALTKTELKNLEIPEPKVVIDDTKEVNITATDACHAYYGCIIKNVNNKIQTPLWMVEKLR
RSGIGSISFFVDVTNYVMLLTGQPMHAFDLDKLEGRINVRYAKNNEELTLLDQTQVKLDC
DTLIIADDKKALAIAGVMGGLDSSITDSTTNIFLESAFFVPEKIAGKARKYNLHTDSSHR
FERGVDPQLAKKAMKIAIRLINEIAGGEVAPIHGAEDLANLNKQIKINLSIKKLNHVLGT
NFDIEYVTEVLKALHMDVATSFDGNCIEVIPPSYRFDLEIPEDLIEEVARIYGYSKLPET
MPKYAAAKTNISETYQSLDTLNMRLIDRGYHETINYSFIDPKFDEFFFADRGIAIQNPIS
QDLSIMRQSLIPGLINTFKANTSRQQNRVRIFEKGACFKLQDNQRIQFDRIAGLAYGELL
NINWSNSKKVDFFDVKADVEALCNDLTSLSFEVCNDINWLHLGQSAYILANGNKIGVIGV
IHPTVLKNFQIKAKAPIVFELDLDVLIKRQIPNFTKISKYPSVSRDISFLVDKSVLAGDI
IKAIKALNINILKDVSIFDIYESQDSDRKSIALNMLFQDNLQTLDDKVIVESIDKVLEAL
KTKFNIEQRV
Download sequence
Identical sequences A0A0E2ZIA2 A0A0M1U4D3 Q5NG54
gi|379717334|ref|YP_005305670.1| gi|56708092|ref|YP_169988.1| gi|385794758|ref|YP_005831164.1| 177416.FTT_1002c 393115.FTF1002c gi|379725938|ref|YP_005318124.1| gi|110670563|ref|YP_667120.1| WP_003021090.1.101979 WP_003021090.1.11695 WP_003021090.1.1833 WP_003021090.1.19035 WP_003021090.1.2301 WP_003021090.1.25812 WP_003021090.1.31410 WP_003021090.1.35965 WP_003021090.1.36081 WP_003021090.1.3831 WP_003021090.1.38368 WP_003021090.1.38474 WP_003021090.1.38662 WP_003021090.1.40634 WP_003021090.1.44744 WP_003021090.1.52816 WP_003021090.1.56738 WP_003021090.1.5829 WP_003021090.1.59625 WP_003021090.1.60146 WP_003021090.1.61154 WP_003021090.1.65967 WP_003021090.1.66077 WP_003021090.1.66092 WP_003021090.1.67317 WP_003021090.1.75261 WP_003021090.1.77053 WP_003021090.1.80616 WP_003021090.1.82545 WP_003021090.1.87851 WP_003021090.1.98147 YP_169988.1.84429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]