SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120612095|ref|YP_971773.1| from Acidovorax citrulli AAC00-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120612095|ref|YP_971773.1|
Domain Number 1 Region: 12-303,368-398
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.35e-78
Family Type II chitinase 0.00000299
Further Details:      
 
Domain Number 2 Region: 305-370
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000266
Family Chitinase insertion domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120612095|ref|YP_971773.1|
Sequence length 414
Comment glycosyl hydrolase family chitinase [Acidovorax citrulli AAC00-1]
Sequence
MSAHAHAYAHAAAPAREMVGYFTSWGIYARGYTARSLASQGALPRITTLNYAFGSVAPAS
ADGSGPVGCRLGDAWADVERPWTAEESVDGTAVDDTQPLRGNFQQLRALKRLRPGLKVLV
SLGGWNGSKWFSDAALTPASRSAFVKSCVDLFIRGRTGGETEGDGPAAGVFDGIDIDWEH
VAAEAAPGNIVRPEDTANFTLLLQEFRRQLDAIDPALRLTIAAPAGPQNSAKIELAAVAK
TVDFINLMAYDLHVSPERRTNHQAALAPSPRDPDRAKDLSVVEAVGRYLQAGVPRSKLVV
GAPLYSQGWSGVNPAGNGLYQPATGPAQGTYEAGVDDFKTVRAKPGFTRHRDAWSRAAWL
FDGSTFWTFDDEQVVREKARTVRAAGLRGMMFWELSGDGGELVRAAGEELSTGR
Download sequence
Identical sequences A1TSR1
397945.Aave_3442 gi|120612095|ref|YP_971773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]