SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120613240|ref|YP_972918.1| from Acidovorax citrulli AAC00-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120613240|ref|YP_972918.1|
Domain Number 1 Region: 5-154
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 5.58e-19
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|120613240|ref|YP_972918.1|
Sequence length 156
Comment transcription activator [Acidovorax citrulli AAC00-1]
Sequence
MIETPRIVQMEAQPAALWPVSCTREEIQQVMGRSVRALMDALAAQGVSPAGPLFTHHLRR
PTDTFEFHLGVPVDKPVGPGPDGGLQPGEWPAMRVARTEYRGRYEDLPQAWETFHRWIGA
QGVRPAEDVWERYLTGPETGSDPGGWRTELIQPLAD
Download sequence
Identical sequences A1TW06 F0QA52
gi|120613240|ref|YP_972918.1| 397945.Aave_4607 gi|326319315|ref|YP_004236987.1| WP_011797611.1.2034 WP_011797611.1.45855 WP_011797611.1.49867 WP_011797611.1.56291 WP_011797611.1.74814 WP_011797611.1.92537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]