SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120609462|ref|YP_969140.1| from Acidovorax citrulli AAC00-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120609462|ref|YP_969140.1|
Domain Number 1 Region: 33-380
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.07e-82
Family L-arabinose binding protein-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|120609462|ref|YP_969140.1|
Sequence length 380
Comment extracellular ligand-binding receptor [Acidovorax citrulli AAC00-1]
Sequence
MKQAELGRRRFSIGLGVAAAAGFGLARAQPEGPIVLGQSAPLSGPSAQLGVQFHAGAKLY
FDALNAQGGIGRRPVELRTLDDGYEPDRCAANTRKFIEQDVLALFGYVGTPTSLAALPLF
NQARVPFFAPFTGAEALRQPFNRLIFHVRASYHDETAVIVRQLTHLGLRRIAVLYQDDAY
GKAGLDGVTAALAQDQLKPHATATVPRNSVDVAPAVAKLVAARPESIVLVTTYAASAAFV
RAARKAGYGGTFYNLSFVGTQALADALGRDGAGVVVSQVMPSPYQTTRQIAREFQDAIRK
GGNKVQANYSSMEGYVAARVFAEGLRQGGGKPTRESLVAGLEAIGTTTVSGYPISFSGSS
HAGSRFVEMSMLTGDGRVKV
Download sequence
Identical sequences A1TK78
gi|120609462|ref|YP_969140.1| WP_011793926.1.2034 WP_011793926.1.45855 WP_011793926.1.56291 WP_011793926.1.7412 WP_011793926.1.74814 397945.Aave_0768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]