SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120609969|ref|YP_969647.1| from Acidovorax citrulli AAC00-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120609969|ref|YP_969647.1|
Domain Number 1 Region: 36-405
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-90
Family L-arabinose binding protein-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|120609969|ref|YP_969647.1|
Sequence length 406
Comment extracellular ligand-binding receptor [Acidovorax citrulli AAC00-1]
Sequence
MKKHPRTIATFKTLAVALGLAGLCAAPVVQAQDGKVKIGFITDMSSLYADVEGKNGAVAI
QMAIDDFGGKVLGMPIELVSADHQNKADIAASKAREWIDTQGLTMLFGGTNSGTALAMAK
VAQEKKRVFIVNGAGTSALTNEQCSPYTVQYAYDTVALAKGTGGAVVQQGGRDWFFLTAD
YAFGAALEADTAKVVKEKGGRVLGSVKHPLNASDFSSFLLQAQNSKAQILGLANAGGDTI
NAIKAAREFGINKSMKMAGLLVFLTDIHSLGLKNTEGLLLTTSWDWNLDDKTRAFGRKFF
AKTKRMPTDIQAADYSATMNYLKAVEAAKSTDADKVMEKLKSTPIDDFYAKGSIRPDGRF
AHDMYLMQVKSPAESKEPWDYYKVVARLPADQVWTTKAESKCALWK
Download sequence
Identical sequences A1TLN5
397945.Aave_1282 gi|120609969|ref|YP_969647.1| WP_011794425.1.2034 WP_011794425.1.45855 WP_011794425.1.56291 WP_011794425.1.7412 WP_011794425.1.74814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]