SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120610702|ref|YP_970380.1| from Acidovorax citrulli AAC00-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120610702|ref|YP_970380.1|
Domain Number 1 Region: 40-360,387-494
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.74e-129
Family Amylase, catalytic domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 783-1125
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-16
Family APH phosphotransferases 0.055
Further Details:      
 
Domain Number 3 Region: 499-579
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000000096
Family alpha-Amylases, C-terminal beta-sheet domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|120610702|ref|YP_970380.1|
Domain Number - Region: 704-798
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0966
Family D-glucarate dehydratase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120610702|ref|YP_970380.1|
Sequence length 1142
Comment trehalose synthase [Acidovorax citrulli AAC00-1]
Sequence
MNAPLLRQPLPAADAAAGPLPEPGPVVMPETPEIDTQGDPQWYRDAVIYQLNVKAFFDSN
NDGYGDFKGVTAKLDYVKDLGVNTIWLMPFYPSPLRDDGYDISDYENVHPQYGTLADFKE
MLDAAHARGLRVITELVINHTSSEHPWFQRARRAPPGSPERDFYVWSDTDQIYRGTRIIF
TDTETSNWAWDPVAKQYYWHRFFSHQPDLNFDNPLVLEAVFKTMRFWLDMGVDGFRLDAI
PYLVERDGTSNENLPETHAVIKKLRAAIDAEYRNRFLLAEANMWPEDVREYFGDGDECHM
AYHFPLMPRMYMAIAQEDRHPIVEILQQTPDIPEGCQWAIFLRNHDELTLEMVTSKERDY
MYSMYAADMRARINLGIRRRLAPLMENDLDRVKLMNGMLLSMPGSPIIYYGDEIGMGDNV
FVGDRNGVRTPMQWSPDRNGGFSRSDPQRLYLQPIMDAVYGYEALNVEAQSGDHSSLLHW
TRRMLAVRKTSRAFGRGRRTFLKPGNRKILAYVSEHEDDVILTVFNLSRAAQPVELDLSA
YRGRTPIEMLGRVTFPPIGDLPYLLTLHSYGFYWFRLSNEAPMPSWHQEGLDLQERPVLV
LFDGWTSFFRERVMPWRIGMAERMRAQFEDDTLPRFIELQRWYADKGATIAGARILDHTV
WKAGEGCEWMLPLLGVEPAAKPGGAQGAGATYFVPLALAWEEGSEERMRRISPAGVARVR
QQAQVGVMGDAFHDESFCRMVVRAMGEGTELATDQGGRVRFRRTSAFDALAAELDTLPVE
RPGAQSSNTVVALGETLFLKGYRRLREGVNPELEVGRFLTEVARFPHCVPVAGSVEYVAP
DGATMTLALVQSYVANQGDGWEYTLGYLERFLEDTRLAQAAGPVADMHGGYLALAATLGQ
RTAQLHQALARRTGDAAFDPEPVTTQDVAAFGQRARAEAEDTLVLLERRLGELPPAAQTD
AQAVLARRALIMERLAAGGADAPAGTKTRFHGDYHLGQVLVTGNDFVIIDFEGEPGRPFE
ERRAKSSPLRDVAGMLRSFNYARWAALKHMTQSTEEMVRLDEAARHWEHQVRDAFLAAYA
AEGLAADPALISLFELEKALYELRYELGNRVDWAQVPLQGILALIGAAAAPTPTPNLPDT
PA
Download sequence
Identical sequences A1TNR8
WP_011795146.1.7412 WP_011795146.1.74814 397945.Aave_2022 gi|120610702|ref|YP_970380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]