SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120610929|ref|YP_970607.1| from Acidovorax citrulli AAC00-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120610929|ref|YP_970607.1|
Domain Number 1 Region: 30-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.95e-74
Family L-arabinose binding protein-like 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120610929|ref|YP_970607.1|
Sequence length 322
Comment periplasmic-binding protein/LacI transcriptional regulator [Acidovorax citrulli AAC00-1]
Sequence
MTKLTRRTLATALACAPVAALLPAAAWAQKPIVLGFSQVGAESEWRTANTESIKSAARDA
GIELKFSDAQQKQENQIKAIRSFIAQRVDVIAFSPVVESGWEPVLREAKAAKIPVVLTDR
AVNTKDTSLYVTFMGSDFVEEGRKAGRWLVEKMKDAKGDVNIVELQGTVGSAPAIDRKKG
FEEVVKADPKFKIIRSQTGDFTRAKGKEVMEAFLKAEGRKINVLYAHNDDMAIGAIQAIE
EAGLKPGKDITIISIDAVKGAFEAMMAGKLNVTVECSPLLGPQLMAAVKDIKAGKTVPKR
IVTEEGIFPMETAAQEFPKRKY
Download sequence
Identical sequences A1TPE5
gi|120610929|ref|YP_970607.1| 397945.Aave_2255 WP_011795369.1.2034 WP_011795369.1.45855 WP_011795369.1.56291 WP_011795369.1.7412 WP_011795369.1.74814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]