SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120612457|ref|YP_972135.1| from Acidovorax citrulli AAC00-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120612457|ref|YP_972135.1|
Domain Number 1 Region: 33-379
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.06e-67
Family L-arabinose binding protein-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|120612457|ref|YP_972135.1|
Sequence length 394
Comment branched chain amino acid ABC transporter periplasmic ligand-binding protein [Acidovorax citrulli AAC00-1]
Sequence
MQHTLQGRRALLRGMAAILACGTAPAAVRAAAPLKIGLLTPFSGPLARVAEANRNCLMMA
VDEINAAGGLLGQALQIVSEDSQMSAKVSLDKARKLLAGDGVAMVTGMVLPFEREAVLQV
ASRYRRLVVYPNFDEGRCHPLLLTTGLASNQRVVPLIDWAVAQAGKSFFVLASDIGSNRS
TLLPQIEAAIQARGGRLLGTRFFPFGTRDYGPALQQIQGLGADVVWHSIGDDPVSFVKQY
RSFGMKPQLITDIAHESLAMSTEGALAGTVGVSSYFMGVENPENQRFLDTYTRRFSDATP
LRVGGHVVMLPHGESTYAGAKLFAAAAGRAGSIEADAVKKALPGVSLRMPRGAVGVDAGA
SHLQCQTMIGRARKDGGFDLLGAAPSIQAQCGAA
Download sequence
Identical sequences A1TTS3
WP_011796848.1.2034 WP_011796848.1.45855 WP_011796848.1.56291 WP_011796848.1.7412 WP_011796848.1.74814 gi|120612457|ref|YP_972135.1| 397945.Aave_3816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]