SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120613378|ref|YP_973056.1| from Acidovorax citrulli AAC00-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120613378|ref|YP_973056.1|
Domain Number 1 Region: 33-399
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.38e-74
Family L-arabinose binding protein-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120613378|ref|YP_973056.1|
Sequence length 401
Comment branched chain amino acid ABC transporter periplasmic ligand-binding protein [Acidovorax citrulli AAC00-1]
Sequence
MQRRHLLQLSALGALPASLGLARGAWAQSTGAIQFGCPVPMSGAFAANGKFADLGMKLAI
EQYGKALGRPLAYTVLDTEGKPATAVRKVQEASQQQGTRFFAGGILSSESLAMGKEAEKA
GGIFITTAGADEITGKDCNAATFRWSVPTFGAIEQTVRPLADALPKAKRWYTITPQYVFG
DGLLSAAKNVFKEKGLEHVGNSYHSLTEKEFSGYLTNAMAARPDVLLLLNFGSQSSDALR
QAVSFGMHKNMTILIAWASGLEQFESLGADLCDGIYFGAQYWHTVDAPLNLELVKRSQEK
FKSNPNYSLAGSYICTKLLIDGIIKAGTADQKAVIAALEGMKYAGLTGEEEVRRGDHQVL
KNYYLLKGKPRAKMANKDDYVDVVSSGKSFLPVDQTGCKLG
Download sequence
Identical sequences A1TWE4
WP_011797748.1.56291 WP_011797748.1.74814 397945.Aave_4750 gi|120613378|ref|YP_973056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]