SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126458778|ref|YP_001055056.1| from Pyrobaculum calidifontis JCM 11548

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126458778|ref|YP_001055056.1|
Domain Number 1 Region: 86-269
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.65e-33
Family Clp protease, ClpP subunit 0.02
Further Details:      
 
Weak hits

Sequence:  gi|126458778|ref|YP_001055056.1|
Domain Number - Region: 357-473
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00392
Family Nuclease 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126458778|ref|YP_001055056.1|
Sequence length 612
Comment peptidase S49 [Pyrobaculum calidifontis JCM 11548]
Sequence
MRALWAVSLLALVLAAAALVGWFSLQVSLGEVKAEVGKLGKDVATNLNSLEKRVANISAS
VDKLLNATRGLEERVSKLEAKKAAEKEIVVVPVDFAIYDYEVDFLVKYVKRLEFDDRVAG
VVLLINSPGGAVGATERLYSTIAGLNKTKYAVIAGLGASGAYYTAVAAEKIYATPSSWVG
SVGVIALIAPEDYLAEVPDWIYTTGPWKYYGKDLLALYDDVEKTRENFVNAVLKGRGDRL
KDLKAVETAEIFRADEALRIGLIDAIGGLWDAVRDMAKELGLKNYTVVDIYERHNATRYT
GIVIPLLGGKIDAKTLLRLSPEPIFYIYPGAVQFDGFPNATVPPVQVAVEERRGAPYVVL
DMSHGNAVPLPLLEPLAAELVPRGYGIRVANSESELVKLLDNATGLIVVNPTQPFSEEAL
SAVVNATRRGVRVLYMVDVKSPVFLSYGFIIVFTSYNAPLYVHNLLAYFNATVVHRAVYN
DTAAGAKTFTENWQFLHVTDFPNSTLFRGVRRLVLFGATPAFTRAQYRVDVRGAVRGYGP
GNYTVAFAVGNFTYVGSVRSFTPYFIQLGDNKKFFSNLVEWLVEPRPIAPPPKKAETTPT
YPYYPVPIPPVK
Download sequence
Identical sequences A3MSH3
gi|126458778|ref|YP_001055056.1| 410359.Pcal_0153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]