SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126459364|ref|YP_001055642.1| from Pyrobaculum calidifontis JCM 11548

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126459364|ref|YP_001055642.1|
Domain Number 1 Region: 7-274
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 4.19e-54
Family NIF3 (NGG1p interacting factor 3)-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126459364|ref|YP_001055642.1|
Sequence length 280
Comment protein of unknown function DUF34 [Pyrobaculum calidifontis JCM 11548]
Sequence
MSLRRPTLRDVVEVLESIAPPSLAMEEHRNRLGLVVGPLHGLEEVAVERIGFSLNPSIRA
IRAAVERGAQLLVVHHEYFLFPRAEDSAPVIYSYRDRVLELLRRHRLYLYAAHTNWDFAE
GGNFDTLARLLGLEARPLPLKLGNLVLKKAVLAAELPRPMKLRELAQYVKERLGLRHIAY
VDGGREEVRRVALSTGGGFFVDFVVQLADLGFDVYISGELSEEAAEVAKDLGIGLIAATH
YQTEYIGMVELRRRTEEELRRRGLQAETFVIDTGVPFEIT
Download sequence
Identical sequences A3MU59
gi|126459364|ref|YP_001055642.1| 410359.Pcal_0750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]