SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126459452|ref|YP_001055730.1| from Pyrobaculum calidifontis JCM 11548

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126459452|ref|YP_001055730.1|
Domain Number 1 Region: 9-253
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 5.63e-84
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000173
Further Details:      
 
Domain Number 2 Region: 240-395
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 2.26e-51
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126459452|ref|YP_001055730.1|
Sequence length 410
Comment Butyryl-CoA dehydrogenase [Pyrobaculum calidifontis JCM 11548]
Sequence
MVFPFDSVEDFSVVLTPEHEMFRKAVREFVEREVAPKAMEIEEKDEVPWDLLKKIAEQGF
FGIGIPEKYGGQGGDHRMAVIMSEEFCRVLPGLSVYFGTNELFLTPILLFGTEEQKQKYV
PPIARGEKFGAFAVTEPCCGSDVAGIQTKAEKVGNKWVINGRKAFISSSDVADYFIVLAR
TYPPPDKKLRYLGLTFFIVEKGTPGFKIEQCYHKMGLHGNHVCELVFENVEVPDENRVGE
EGMGFLYAMETFDRTRIGVAAQAVGMMQGVFEKAFQYVHQRQAFGLPIAAFQAIQFSLVE
MMTKIMTARLLTYLAAKLADENRKEFTFVASLAKYYATSVAEEVISEAINLHGGVGVIVE
TGVERYLRDVKITQIYEGANNIQKLVAYRQLIRILKEKGQIPDEIAKFVT
Download sequence
Identical sequences A3MUE7
410359.Pcal_0838 gi|126459452|ref|YP_001055730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]