SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126459525|ref|YP_001055803.1| from Pyrobaculum calidifontis JCM 11548

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126459525|ref|YP_001055803.1|
Domain Number 1 Region: 34-348
Classification Level Classification E-value
Superfamily ADC synthase 1.7e-92
Family ADC synthase 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126459525|ref|YP_001055803.1|
Sequence length 357
Comment Anthranilate synthase [Pyrobaculum calidifontis JCM 11548]
Sequence
MEGRAYFRSDVVEVYVEGQVTWDVEEVARAVGRGEVAVGVFTFDFSPWEGVAVRRRERWP
GALFVVGRPTSPIFSRPARCRVEHLGGSGGFLGAVAAAKEALARGEVFQLVLARFEKYLV
ECPIDTVYRALAEASEGRYHFFFEAGEVALAGVSPEILARVEGRRVLSGPIGGTRPRGRT
ADEDRALEEELVSSVKERAEHIMLVDSVRNDLGRVCAWGSVRPVEVLKVEKYSYVQHLVS
YVEGVLDRFYRPIDAVLALNPTTTVVGVPKPRAMSLIDMLEEEPRGPFAGSFGVLAKDFA
DFAVVIRSVYGEGDTFYVWAGAGIVADSNPAWELRETEVKMAPAKAALRRLGSSPPP
Download sequence
Identical sequences A3MUM0
gi|126459525|ref|YP_001055803.1| 410359.Pcal_0912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]