SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126459920|ref|YP_001056198.1| from Pyrobaculum calidifontis JCM 11548

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126459920|ref|YP_001056198.1|
Domain Number 1 Region: 9-255
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.03e-67
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.000095
Further Details:      
 
Domain Number 2 Region: 244-402
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.26e-52
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126459920|ref|YP_001056198.1|
Sequence length 407
Comment acyl-CoA dehydrogenase domain protein [Pyrobaculum calidifontis JCM 11548]
Sequence
MAEFRIMVDPYLIPEQYKSEIELVRKTAREFAQRYFTRELAREVDHKEEFPWDLYRKAGE
LGFIAATLPPEYGGGGLTTELASAVITEELVRADTTLGQGILSGAFGLYALYLFGTEEQK
KQYIPPVARGEKTFFLALTEPDHGSDITQLSTVAKKEGDYYVLKGIKTFITNAPTAEYGL
ILAQTEPEKGYRGQTLFLIHTDWPGVDVKPLKGKMGQRASPLGEIRLDGVKVPKEYVVGG
PEGLNKGFYWALQYLNIGRVHVGAVALGMMLAAFDRAYDFAQKRVQFGRPIIEFQLIQQK
LAEMAQLIDISRLAVYRAHLILDEYIKGAVEPRTMAAISSITKVFVTENATKVIDHAIQI
LGGSGYMEEYDVERIWRDHRVTRIYEGTTEINTLTIVDSLRRGFYTL
Download sequence
Identical sequences A3MVR5
gi|126459920|ref|YP_001056198.1| 410359.Pcal_1308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]