SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470153630|ref|YP_006282132.1| from Pectobacterium sp. SCC3193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470153630|ref|YP_006282132.1|
Domain Number 1 Region: 4-109
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.27e-33
Family 2Fe-2S ferredoxin-related 0.00000552
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470153630|ref|YP_006282132.1|
Sequence length 111
Comment Ferredoxin, 2Fe-2S type, ISC system [Pectobacterium sp. SCC3193]
Sequence
MPKIVFLPHQDLCPEGAVLEAERGESILEVALRNGIDVEHACEKSCACTTCHCIVREGFD
SLAESTEEEDDMLDKAWGLEPESRLGCQARVAGDDLVVEIPRYTINHAREH
Download sequence
Identical sequences A0A0H3I0N9 A0A0J5XTL7 A0A2I1BLI2 D0KK06
561231.Pecwa_1249 gi|470153630|ref|YP_006282132.1| WP_014698950.1.14155 WP_014698950.1.19434 WP_014698950.1.36680 WP_014698950.1.70306 WP_014698950.1.77019 WP_014698950.1.78307 gi|261820564|ref|YP_003258670.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]