SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150400680|ref|YP_001324446.1| from Methanococcus aeolicus Nankai-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150400680|ref|YP_001324446.1|
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000562
Family GHMP Kinase, N-terminal domain 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|150400680|ref|YP_001324446.1|
Domain Number - Region: 267-314
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00408
Family Homoserine kinase 0.033
Further Details:      
 
Domain Number - Region: 220-296
Classification Level Classification E-value
Superfamily Hypothetical protein MPN330 0.0248
Family Hypothetical protein MPN330 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150400680|ref|YP_001324446.1|
Sequence length 335
Comment beta-ribofuranosylaminobenzene 5'-phosphate synthase [Methanococcus aeolicus Nankai-3]
Sequence
MIKLISPSRIHMGLIDLNGSIGRVDGGIGITIDYPNFVIEGRGSSQIDIEFNKNILNNFN
PQDLKDIENRIYNSSKEILKYMGEEGIYLKINEIMPQHNGLGSGTQISLATGKIISEIYN
KKLNAKTISKITGRGGTSGIGVYSFEKGGFIIDGGHSFGKDKNKEKQDFKPSSASKNTPV
APLLFRHDFNWDIVLTIPKGKNICGDKEIDIFKKYCPISLNETQKICHLILMKMMPSIIN
NDFNSFGEVVNELQYIGFKNIERELQKPAVKELIKNLQKISYSGLSSFGPTIYSLCNGKE
DIQKVKEYSNEFFDNNGIEGEIIITKANNTGHKIL
Download sequence
Identical sequences A6UTL2
gi|150400680|ref|YP_001324446.1| 419665.Maeo_0244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]