SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150400683|ref|YP_001324449.1| from Methanococcus aeolicus Nankai-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150400683|ref|YP_001324449.1|
Domain Number 1 Region: 11-161
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.09e-21
Family GHMP Kinase, N-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 237-288
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000000233
Family Homoserine kinase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150400683|ref|YP_001324449.1|
Sequence length 294
Comment shikimate kinase [Methanococcus aeolicus Nankai-3]
Sequence
MDKTGSSSAMALASGTIINAIATGKGSAFGIDLNVCATVELIDDGKKRIKGIIKDHPTVK
PNLIETCVKNVLNYFELDYSATVSTKTTIPVKSGLSSSSATSNAVVMATIDAIGEKLDPK
LILDLAIKSSFDEKLTITGAYDDATASYYGGITITDNTKRELIKRDTFKSNNESIEDIID
VLILIPNLNKNVNVNRMKLLKNSVAVAFKECLAGNYYNALFLNGILYASALNFPTNIAIE
AIESGALTAGLSGTGPSYIALCNKENTENVKNTLNKYGKVIITKLNNKGASIVW
Download sequence
Identical sequences A6UTL5
gi|150400683|ref|YP_001324449.1| 419665.Maeo_0247 WP_011972969.1.55018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]