SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150401261|ref|YP_001325027.1| from Methanococcus aeolicus Nankai-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150401261|ref|YP_001325027.1|
Domain Number 1 Region: 2-171
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.42e-33
Family GHMP Kinase, N-terminal domain 0.00000459
Further Details:      
 
Domain Number 2 Region: 176-307
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.34e-30
Family Homoserine kinase 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150401261|ref|YP_001325027.1|
Sequence length 312
Comment homoserine kinase [Methanococcus aeolicus Nankai-3]
Sequence
MKMVKICSPATSANLGPGYDVFGLALNNPYDTITVSIVEEKGGNETLSNEKITISMEGEK
CEEIPTAVDENTAGVVAKKMMEDFNIDKNIQIHIEKGIKPGSGLGSSSASCAGVAVAINE
LFGLELPKLELVKYASLGEAVAAGAPHADNVAPAIYGGFTMVVNQDPLEIIHIPVEFEVL
VALPNIQISTKEARELVPKEIPIKDMVNNVGKACGMIYSLHDNNVELFGKYMMQDAVVEP
CRATLIDNYSEVKEKVKDLVYGITISGSGPAIISLPKKECVLEVKKIFKETWDCPIYYTT
LGAGAYVVKEEE
Download sequence
Identical sequences A6UV93
419665.Maeo_0833 gi|150401261|ref|YP_001325027.1| WP_011973547.1.55018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]