SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150401384|ref|YP_001325150.1| from Methanococcus aeolicus Nankai-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150401384|ref|YP_001325150.1|
Domain Number 1 Region: 65-194
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.77e-37
Family MJ1460-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150401384|ref|YP_001325150.1|
Sequence length 197
Comment 4-vinyl reductase 4VR [Methanococcus aeolicus Nankai-3]
Sequence
MKMELKTKNMEDFLTILGKNDDDATQGGGIYLSNDDELIKETVEHLKKGYDKEKYTFIES
KYTNRNIKEYVPLEILRLMIMIMMKKIKELNSEITLYDIGYEFGRHINPKNYMELKKFFR
KNNLGVLKIESKNPVIIKVNDCALCDGLKSNESICYFDAGVLAGAYECILNKTVVVDEIR
CMAQGADACYFKIEPVK
Download sequence
Identical sequences A6UVL6
WP_011973670.1.55018 419665.Maeo_0960 gi|150401384|ref|YP_001325150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]