SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EFV56588 from Trichinella spiralis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFV56588
Domain Number 1 Region: 269-350,459-657
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 7.14e-63
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000324
Further Details:      
 
Domain Number 2 Region: 96-242
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.16e-21
Family Mevalonate kinase 0.00044
Further Details:      
 
Domain Number 3 Region: 350-443
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 1.31e-20
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EFV56588
Sequence length 659
Comment pep:novel chromosome:Tspiralis1:GL622787:9542741:9553332:1 gene:EFV56588 transcript:EFV56588 description:""
Sequence
MQICHKRIGKYVNIRFKHCIGLILPKSFVNSVLTAVAGCIDLRTYVNLFTSADGRIYLSL
PDLGVERTWLMKDVRKAVDKLYGGVASYRHGCKIEQLEKYCIFPEVIDGIFNAIDAISRD
AIKILGQPQHSKNRKTCSEDEHYSLQEWSMELYSDVNELCRINNQLLIALGVGHPKIDQI
CTTLARYGIHPKMTGAGGGGSLFAFLKPNTSQTVIDMITSEVHKLGYDLWQPKLGGSGVV
LHSSIPEEFRLTNEKFYYYTMSCAKVTQPVCLVVIDGWGMCGSANVSDCFFLTNSGNAIC
NAKTPVMTRLFGENSTQLEAHGLHVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRINMAVT
SGKIKENATLVNACKNASNKNGRLHLLGLYGQLATVVGRYYAMDRDKRWERNQIAYEGLV
AGRGEKATEDTLIEYISCMTQYNKDFTFPLLFPPESHKNVLAEWLAANSIPQFHCAETEK
YAHVTFFFNGGREAPFDHEDRLMIPSPKVATYDLKPEMSCMEVGSKMAEIIRTKNYPFVM
CNFAPPDMVGHTGIYEAAVKACEATDCAIGLVEKACQEAGYVLMITADHGNAEQMFDPKG
GKHTAHTCNRVPFISTGKRRLMAKLPDREPALCDVAPTVLDQMGLAIPSEMGGKSLLQN
Download sequence
Identical sequences E5SF79
EFV56588 XP_003378167.1.5133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]