SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EFV60997 from Trichinella spiralis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFV60997
Domain Number 1 Region: 317-410
Classification Level Classification E-value
Superfamily HesB-like domain 2.35e-25
Family HesB-like domain 0.00062
Further Details:      
 
Domain Number 2 Region: 247-286
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.000000000000549
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0007
Further Details:      
 
Domain Number 3 Region: 7-50
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000811
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EFV60997
Sequence length 431
Comment pep:novel chromosome:Tspiralis1:GL622785:2471224:2473944:-1 gene:EFV60997 transcript:EFV60997 description:""
Sequence
MSAFYHNNPVNRIYRGVIEEVCNASRESFLDEGLDEQVLQDFKQVWESKVLATKAIDSFN
DHPPAPLLRSNFMQMPPTVAVPITQQMIQPIQLTQSLPSSLAFSHGVFTNNPPGFVVQPL
RGGTAVRFVPASAAIHGRPAFFASNILTAASGTAQTVQQSVVSSKNVNQVTGSTPSTEVK
TERSTASKVIYQIDGPAADSEEELEEIDDEECDLVNLVDDSTENAGPVEDGEPLNSDDDI
SVGDPCEIFESDNVTACQYEKVTRTRNKWKFIFKDGIMNINGKDLVKAMLYRWFSQTAGS
ARVVKTAKKVINTRVPVIITDRAKNKICEYLKQKPEMAGLKIGVKQRGCSGLSYTLNYVR
TKENTDEEVIFNGVHIFIEPKALLTIIGSEIDYVETRLSTEFVFRNPNIKATCGCGEIHF
LMQLTGAGTET
Download sequence
Identical sequences E5S2I3
EFV60997 XP_003379384.1.5133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]