SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EFV61509 from Trichinella spiralis 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EFV61509
Domain Number - Region: 12-38
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0523
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EFV61509
Sequence length 125
Comment pep:novel chromosome:Tspiralis1:GL622785:397450:397854:-1 gene:EFV61509 transcript:EFV61509 description:""
Sequence
MNSTEFNDMISAYYRHSSINQCWQRQLEKFLSNGRLNEISQWKTKEWKILWTNQPVFKQL
LSIYSKRTENEGKSSCPKQGNIAQDLENFHEYPHYHVKKKFYTQIPPIPGTGFKKSFNSA
GLPVY
Download sequence
Identical sequences E5S124
XP_003378875.1.5133 EFV61509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]