SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116627356|ref|YP_819975.1| from Streptococcus thermophilus LMD-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116627356|ref|YP_819975.1|
Domain Number 1 Region: 11-393
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 2.75e-137
Family ArgJ-like 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116627356|ref|YP_819975.1|
Sequence length 397
Comment bifunctional ornithine acetyltransferase/N-acetylglutamate synthase [Streptococcus thermophilus LMD-9]
Sequence
MKVIDGTIASPLGFSADGLHAGFKKRKMDFGWIVSEKPASVAGVYTTNKVIAAPLIVTKT
SVKKAGKMRAIVVNSGVANSCTGTQGLEDAYTMQEWTAEKLGVEPDMIGVASTGIIGELL
PMDTLKNGLSKLVVNGNANDFAKAILTTDTATKTIAVTETFGRDVVTMAGVAKGSGMIHP
NMATMLGFITCDANISSDTLQLALSQNVEKTFNQITVDGDTSTNDMVLVMSNGCALNDEI
LPDTPEFDKFSKMLNFVMQELAKKIAKDGEGANKLIQVDVVNAPNALDARMMAKSVVGSS
LVKTAIFGEDPNWGRILAAVGYAGVDVPVDNVDIMLGGLPVMLASSPVTFDDEEMKDIMH
GDEVTITVDLHSGQEKGTAWGCDLSYDYVKINALYHT
Download sequence
Identical sequences A0A0E2RIZ9 A0A0M4HHV2 Q5M122
gi|116627356|ref|YP_819975.1| 299768.str0465 322159.STER_0501 WP_002949910.1.14318 WP_002949910.1.14497 WP_002949910.1.20409 WP_002949910.1.22909 WP_002949910.1.25847 WP_002949910.1.35143 WP_002949910.1.40951 WP_002949910.1.46579 WP_002949910.1.49400 WP_002949910.1.52035 WP_002949910.1.53867 WP_002949910.1.54201 WP_002949910.1.60701 WP_002949910.1.70431 WP_002949910.1.71797 WP_002949910.1.75065 WP_002949910.1.77140 WP_002949910.1.77415 WP_002949910.1.83814 WP_002949910.1.84427 WP_002949910.1.86693 WP_002949910.1.90490 WP_002949910.1.92232 WP_002949910.1.94133 gi|386086157|ref|YP_006002031.1| gi|55822439|ref|YP_140880.1| gi|387909255|ref|YP_006339561.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]