SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116627972|ref|YP_820591.1| from Streptococcus thermophilus LMD-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116627972|ref|YP_820591.1|
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.71e-66
Family Phosphate binding protein-like 0.00000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116627972|ref|YP_820591.1|
Sequence length 216
Comment ATP phosphoribosyltransferase catalytic subunit [Streptococcus thermophilus LMD-9]
Sequence
MTSNQITIALTKGRIEKDAVTLLEKAGFNMSFMADKGRNLIFESPDNRFRFLLVKAPDVT
TYVRHGVADIGIVGKDVLVEHPTGYLEMLDLNFGLCKFCVASTEDYNPNDHKRKRIATKY
PTIATDYFNQKGEDVEIISIQGSVEIAPVIGLADAIVDIVETGSTLVANGLKVYEDICRI
SARMIVNKASLKNNKEVLQFIRKIESLVGNEEVPFE
Download sequence
Identical sequences A0A0E2RGY7 A0A0P6UX52 Q03K77
gi|116627972|ref|YP_820591.1| WP_011681270.1.25847 WP_011681270.1.46579 WP_011681270.1.53867 WP_011681270.1.70431 WP_011681270.1.75065 WP_011681270.1.77140 WP_011681270.1.77415 WP_011681270.1.83814 WP_011681270.1.90490 WP_011681270.1.94133 322159.STER_1205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]