SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116628027|ref|YP_820646.1| from Streptococcus thermophilus LMD-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116628027|ref|YP_820646.1|
Domain Number 1 Region: 223-414
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.59e-67
Family B3/B4 domain of PheRS, PheT 0.00000928
Further Details:      
 
Domain Number 2 Region: 487-708
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.63e-49
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00021
Further Details:      
 
Domain Number 3 Region: 51-211
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-42
Family Myf domain 0.0035
Further Details:      
 
Domain Number 4 Region: 719-816
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 6.15e-30
Family Anticodon-binding domain of PheRS 0.00073
Further Details:      
 
Domain Number 5 Region: 423-495
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.37e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116628027|ref|YP_820646.1|
Sequence length 816
Comment phenylalanyl-tRNA synthetase subunit beta [Streptococcus thermophilus LMD-9]
Sequence
MVLALQGHGLNIIIMLVSYKWLKELVDVDVTTAELAEKMSTTGIEVEGVKTPAEGLSKLV
VGHVLSCEDVPETHLHLCQVDTGDAEGPRQIVCGAPNVTAGIKVIVAIPGARIADNYKIK
KGKIRGMESLGMICSLAELGLPDSIIPKEFADGIQILPEDAVPGDSIFPYLDLDDEIIEL
SITPNRADALSMRGVAHEVAAIYGKSVHFPEKTVTEDSKPASDKISVAIESDKVTTYASR
VVENVTVQPSPQWLQNLLMNAGIRPINNVVDVTNYVLLYFGQPMHAFDLDKLEESHIVAR
DAREGEKLVTLDGEERELTAEDIVITVADKPVSLGGIMGGASTEIDNNSKNVVLEAAVFD
GKSVRKTSSRLNLRSESSSRFEKGVNNDTVLEALDFAAAMLQELANGSVLAGRVQAGSVD
TEPVQVSTSLDYVNVRLGTELTFADIEDVFAKLGFGLTGDADRFTVSVPRRRWDISIQAD
LVEEIARIYGYEKLPTTLPEAAGTSGELTKTQTLRRKVRTIAEGAGLTEIISYTLTTPEK
AVEFAATPSNLTELMWPMTVDRSALRQNLVSGMLDTVAYNVNRKNSNVAIYEIGKVFEQN
GNPKEELPNEINTFAFAISGLVAEKDFQTKATPVDFFYAKGIIEALFKKLEVSVDYVATK
DLASMHPGRTAAIVLDGQTIGFLGQVHPQTAKNYGIPETYVAEINLSAVEDALKPAQPFV
EITKFPAVSRDIALLLKADITHQEVLDAIYSAGVKHLIAVKLFDVYAGEKLGAGMKSMAY
SLTFQNPNDNLTDEEVAKYMEKITKALTEKVEAEVR
Download sequence
Identical sequences gi|116628027|ref|YP_820646.1| 322159.STER_1267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]