SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482898473|ref|YP_007899315.1| from Azotobacter vinelandii CA6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482898473|ref|YP_007899315.1|
Domain Number 1 Region: 816-1187,1218-1285
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.77e-151
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000098
Further Details:      
 
Domain Number 2 Region: 154-369
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 2.25e-61
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0003
Further Details:      
 
Domain Number 3 Region: 370-442
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 9.61e-22
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0071
Further Details:      
 
Domain Number 4 Region: 443-579,763-820
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.66e-21
Family Intein (protein splicing domain) 0.068
Further Details:      
 
Domain Number 5 Region: 664-734
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000085
Family Intein endonuclease 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482898473|ref|YP_007899315.1|
Sequence length 1338
Comment ribonucleoside-diphosphate reductase, alpha subunit precursor [Azotobacter vinelandii CA6]
Sequence
MHTDATRETQSPGAPRTADSTPDLAATAPGQLRVIKRNGTVVAYTDDKITVAITKAFLAV
EGGTAAASSRIHETVARLTEQVTTTFRRRMPSGGTIHIEEIQDQVELALMRAGEHKVARD
YVIYREARAQERKRAAAVQEVAQPHPSIRVARADGVLVPLDMGRLDTIIGEACEGLAEVD
AALIQKETLKNLYDGVAEKDVNTALVMTARTLVEREPNYSYVTARLLMDTLRAEALGFLG
VAESATHHEMADLYARALPVYVEKGIEFELLDPKLREFDLVRLGAALDHERDQQFTYLGL
QTLYDRYFLHKDGIRFELPQVFFMRVAMGLAIEEPQKEERAIEFYNLLSSFDYMASTPTL
FNAGTLRPQLSSCYLTTVPDDLSGIYNAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTN
GKSQGVVPFLKVVNDTAVAVNQCFAPETLVHTADGPRPIRDLQQGDLVLGISGRYREVTH
KFVYNQTDAMLAIRVKHAVEPIEVTAGHPFYAIRGVPLEQSGERTLRQLESGKRSPEWID
AGELERGDYMAQVIPSEVVPVAGFDEDDARLYGILLGDGHLSKNGLQWGVSGHPQRDGHM
DFVRAYLSARGIHFWETARDETYGQIHWASGRGVRRDATTGRITGAGAATLPFEHADLYD
EQGRKRIARRFSHLPRQQSLALIRSLLESDGGVSRGKEIYFTNTSRPLIEGLRYQLLRLG
VPTAGQYRERRQDHVGQRADGSPIRFEGVCKAYDLRIPAVPEVAQLVGCQPIAKRNWITW
QGCVYSRIRDVQPIAVKPFVFDLKVEGDESYMTTSGLAHNGGKRKGAVCAYLETWHLDIE
EFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVFEDGQWTLFSPSDVRDLHDLTGRAFEE
RYEYYEALTQYGKIKLFKTIAAKDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVH
SSNLCTEITLNTSDSEIAVCNLGSINLVNHINDGRLDTEKLSRTVKTAVRMLDNVIDINY
YSVDTARNANFRHRPVGLGIMGFQDALYLQHIAYGSEAAIAFADRSMEAISYYAIQASCD
LAEERGAYSSFEGSLWSRGILPLDSLDILAEQRGTKYIEVDRSSTLDWAPLRERVKKGMR
NSNIMAIAPTATISNIVGVSQSIEPTYQNLYVKSNLSGEFTVINPYLVHDLKARELWDGV
MVNDLKYYDGSVQQIERIPTDLKALYATAFEVETKWIVEAASRRQKWIDQAQSLNLYIAG
ASGKKLDVTYRMAWFRGLKTTYYLRALAATSAEKSTINTGKLNAVSSVIDESLSAAEPKP
APVPQACSIDNPDCEACQ
Download sequence
Identical sequences C1DPR2 M9YC73
gi|482892880|ref|YP_007894266.1| gi|226945385|ref|YP_002800458.1| 322710.Avin_33290 WP_012701867.1.101714 WP_012701867.1.69821 WP_012701867.1.78925 WP_012701867.1.92556 gi|482898473|ref|YP_007899315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]