SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125972739|ref|YP_001036649.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972739|ref|YP_001036649.1|
Domain Number 1 Region: 209-403
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.02e-72
Family B3/B4 domain of PheRS, PheT 0.00000536
Further Details:      
 
Domain Number 2 Region: 471-688
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.49e-44
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00027
Further Details:      
 
Domain Number 3 Region: 35-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.43e-44
Family Myf domain 0.0027
Further Details:      
 
Domain Number 4 Region: 697-795
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.18e-32
Family Anticodon-binding domain of PheRS 0.00028
Further Details:      
 
Domain Number 5 Region: 409-479
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.65e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125972739|ref|YP_001036649.1|
Sequence length 795
Comment phenylalanyl-tRNA synthetase subunit beta [Clostridium thermocellum ATCC 27405]
Sequence
MKAPIDWLKDYVDINVSTKELADAMTMSGSKVEGIEVQGEEITKVVVGKILSLEKHPDAD
RLQVAKVDVGSEVLQIVTGAQNVNVGDYIPVALVGSTLPGGKKISKGKLRGVESYGMMCS
IEELGLTRDDCPDAPEDGIYILPKEEELGKDIKEVLGLNKEIIEFEITSNRPDCLSIIGL
AREAAVTLKTKFKRPVINVKEEGDDASQYISVEVKDTGLCPRFAARVVKDVKIGPSPKWM
RDRLKAAGVRPINNIVDITNYVMLEYGQPMHAYDIKDIKGNKIIVRRAFDGEIIKTLDDQ
DRELDSSMLVIADEERAVGVAGVMGGANSEIKDDTKTIVFEAANFNGTSVRLTAKKLGMR
TEASGRFEKGLDPENVEAAINRAAQLVEELGIGTVCKGMIDCYPEKKEPRIIKLRVDKIN
SLLGTNIPKEEMIDILRALEFEVDENNMTVKVPTFRDDVEREADIAEEIARFYGYNNIEA
TLLSGKTATQGRKTYKQTIEDLIKETMIACGLCETYTFSFTSPKVFDKLNLPADSELRKA
VVISNPLGEDYSIMRTTTIPDMLAVISTNYNRRIEEARLFEMSKVYIPKSLPLEELPEEK
TVLTLGMYGELDFYDLKGVVEELLERLGIKNYDVSPEKNNVVFHPGRTALINIDGEYAGI
IGEIHPEVAEKFECPERTYIGVIEVETLVRKASMDCQYKGLPKYPAVTRDIAMLVKDEVM
VKEIEDIIKQRAGKILESVKLFDVYKGKQVPEGMKSVAYSITFRASDRTLTDEEVGKAMT
KILDGLKRNLGAELR
Download sequence
Identical sequences A3DBX7
203119.Cthe_0215 WP_003512315.1.16390 WP_003512315.1.19387 WP_003512315.1.20586 WP_003512315.1.31213 WP_003512315.1.55520 WP_003512315.1.60145 WP_003512315.1.6636 gi|385779347|ref|YP_005688512.1| gi|125972739|ref|YP_001036649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]