SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125972782|ref|YP_001036692.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972782|ref|YP_001036692.1|
Domain Number 1 Region: 396-578
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.84e-33
Family Prokaryotic proteases 0.00079
Further Details:      
 
Weak hits

Sequence:  gi|125972782|ref|YP_001036692.1|
Domain Number - Region: 276-349
Classification Level Classification E-value
Superfamily (2r)-phospho-3-sulfolactate synthase ComA 0.00589
Family (2r)-phospho-3-sulfolactate synthase ComA 0.011
Further Details:      
 
Domain Number - Region: 232-286
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.017
Family Cell division protein ZapA-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125972782|ref|YP_001036692.1|
Sequence length 707
Comment peptidase S1 and S6, chymotrypsin/Hap [Clostridium thermocellum ATCC 27405]
Sequence
MKITGVIVRIHKDRAIIRTDDNRLLAVKRHNDMMVGQIVSFDANEVHKVESKKYKYAASG
KRIEKVQKTPKIKNFSRINNIKEFSRVDDIKNFSRVAATKETSQDSPQESKVENFSRVVD
FSRVMNFSRVSNSKKNEIKNFSRISNIKNFSRIASIAAAFVLIFLFGRNVMLNNSSDSEY
AYVSVDVNPSVEFTINSKHKVIVTSAINQDASEVLDGLELKEKDLKSALVMVLEKAESLG
YISDDKNYVLVSMALNDKNKKTRDKREEKIDELKETIEQGIEALDNDTIVHRTVTVDLEE
RNKALENELSMGRYYLYLEAKEKGMDITIDEVKSSKISDLIEKIEDNTELAPTPTPVPPE
TPEPTPTPTASEATPSNSPVESKSPEAVPELGSREIEILGESVVLVTAYDENRKVVSQGS
GFAVGTGLFATNYHLVKDGVVVKITAGDGKVYDVDGIVKYDKAKDLALLKTRVETGVNPL
KLGTKKSLTKGSRIVAIGKANGAKNTVTKGSIKSLKVDGLTDAIELSASISKESTGGPVF
DMKGNVVGITAYGISKQNVNAVIPADYVADWVKELSKHSFGNIRIVRKTLVFDSDFEFNF
VVYKIIRALENEDAATYFGCMTDELYKDETRKNLEVLFTTYDLAYNIESINVVSKSEEQA
KVSYVYTINKEAGPNFKNYRIIGECSLIKVDGTWKINDSEEKKEYIQ
Download sequence
Identical sequences A3DC20
gi|125972782|ref|YP_001036692.1| 203119.Cthe_0260 WP_011837788.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]