SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125973126|ref|YP_001037036.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973126|ref|YP_001037036.1|
Domain Number 1 Region: 2-75,161-336
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.56e-65
Family Bacterial dinuclear zinc exopeptidases 0.00000976
Further Details:      
 
Domain Number 2 Region: 65-169
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.98e-20
Family Aminopeptidase/glucanase lid domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125973126|ref|YP_001037036.1|
Sequence length 349
Comment peptidase M42 [Clostridium thermocellum ATCC 27405]
Sequence
MLIKELTELNGVSGNEDEVRKFIKEEAQKYADSITEDSMGNLICYKKGGSSKYRVMLSAH
MDEVGFMVTGYDDGLIKFASIGGIDERILPGKRVLVGEKRIPGVIGSKPIHLQEKAERGN
NIKLKNMYIDIGAEKKEEAEKLAPLGEYIAFYSMYTEFGDGCIKAKALDDRVGCAILLEI
LKERYGFDLYVCFTVQEEIGLRGAGVAAFRVNPDIAIVVEGTTCSDVPGAREHEYSTVMG
NGAALTIMDRTSYSNKKLVDFMYKTAKDKNIPVQYKQTATGGNDAGKIQLTREGVVVASV
SVPCRYIHSPVSVMNRRDYESCLNLVKAVLEEFDNNESLIESFKLHNVK
Download sequence
Identical sequences A3DD14
WP_003516515.1.16390 WP_003516515.1.19387 WP_003516515.1.20586 WP_003516515.1.31213 WP_003516515.1.55520 WP_003516515.1.60145 WP_003516515.1.6636 WP_003516515.1.6965 gi|125973126|ref|YP_001037036.1| 203119.Cthe_0608 gi|385778968|ref|YP_005688133.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]