SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125973244|ref|YP_001037154.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973244|ref|YP_001037154.1|
Domain Number 1 Region: 43-142,275-497
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.62e-106
Family Bacterial dinuclear zinc exopeptidases 0.000000272
Further Details:      
 
Domain Number 2 Region: 143-275
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.92e-36
Family Aminopeptidase/glucanase lid domain 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125973244|ref|YP_001037154.1|
Sequence length 500
Comment putative aminopeptidase 1 [Clostridium thermocellum ATCC 27405]
Sequence
MFIVKAFRDIIINIKFLQEGINMSDNKTAGQKLWENLSYNCPNVWNKIGNDEIKNTFAFC
EEYKSFLDKSKTEREFVRETKKLAESKGFVSIDDVIDSGKPLKPGMKVYRVFKNKIVALA
VIGSQPPEKGFNLVGAHIDSPRIDLKPNPIYEANEMVFLKTHYYGGIKKYQWVTIPLSMH
GVIIRKDGSSVEIVIGEDENDTVFTITDLLPHLAAEQMQKKMSEGITGENLNILFGSIPY
NDEKVKEKVKLNILKLLNEKYNITEEDLLSAELELVPSFKAKDVGLDKSMVGAYGQDDRV
CAYTALRAVLDLDNVDKTAVCVLTDKEEIGSMGNTGAQSSFLENFIADICALSSEKYTDI
ILRRCLSNSKMLSADVNAAIDPTYEGVYDKLNSSFIGKGIVLLKYTGARGKSGASDAHAE
FMGEVRKLFNERKIFWQTAELGKVDQGGGGTIAQFVANMGMDVIDCGVAVLSMHSPFEVT
SKVDIYMAYKAYREFLKYIK
Download sequence
Identical sequences A3DDD2
203119.Cthe_0726 Cth-894 gi|125973244|ref|YP_001037154.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]