SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125973296|ref|YP_001037206.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973296|ref|YP_001037206.1|
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily YheA/YmcA-like 2.88e-24
Family YmcA-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125973296|ref|YP_001037206.1|
Sequence length 130
Comment hypothetical protein Cthe_0778 [Clostridium thermocellum ATCC 27405]
Sequence
MDIFTKAKELGELISNSDEMTNYKKWEASLERDHKARAILREYQYLQTEMVRAAQEDKDK
SVIDDIKERLLSKFDEINNNEITRNYIESKEKLDRLIKKVNDVLVYSISGEEPCPSDDCS
SCSGCRNKSL
Download sequence
Identical sequences A3DDI4
WP_003516352.1.16390 WP_003516352.1.19387 WP_003516352.1.20586 WP_003516352.1.31213 WP_003516352.1.55520 WP_003516352.1.60145 WP_003516352.1.6636 WP_003516352.1.6965 203119.Cthe_0778 gi|125973296|ref|YP_001037206.1| gi|385778792|ref|YP_005687957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]