SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125974578|ref|YP_001038488.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974578|ref|YP_001038488.1|
Domain Number 1 Region: 6-92
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 5.89e-19
Family Cell division protein ZapA-like 0.0039
Further Details:      
 
Weak hits

Sequence:  gi|125974578|ref|YP_001038488.1|
Domain Number - Region: 82-114
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0418
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125974578|ref|YP_001038488.1|
Sequence length 136
Comment hypothetical protein Cthe_2088 [Clostridium thermocellum ATCC 27405]
Sequence
MAEKNKVEVRIAGKDYTLVGCESEEYIQKVALYIDKKMTEIMRMNNKLSTSMASVLTAVN
VADEYFKAQEEIASLSRELKSAKEEIERLKEENRRLANENAVISNKNTYYQLELAKREAE
LNEVRNTLEKSTRARI
Download sequence
Identical sequences A3DH66
gi|125974578|ref|YP_001038488.1| gi|385780016|ref|YP_005689181.1| 203119.Cthe_2088 WP_003514181.1.16390 WP_003514181.1.19387 WP_003514181.1.20586 WP_003514181.1.31213 WP_003514181.1.55520 WP_003514181.1.60145 WP_003514181.1.6636 WP_003514181.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]