SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125974701|ref|YP_001038611.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974701|ref|YP_001038611.1|
Domain Number 1 Region: 9-125
Classification Level Classification E-value
Superfamily FlgN-like 0.00000000183
Family FlgN-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125974701|ref|YP_001038611.1|
Sequence length 162
Comment hypothetical protein Cthe_2216 [Clostridium thermocellum ATCC 27405]
Sequence
MNGTPEGYIQRLVEISKKKMDCLKSILSLTRAQTEAISEEGMDGLQSLIDQKQSKIDEIN
GLDEEFNACFTALKQKLGVKSLDEAGTLGIKGVKELQSLVSKIMGLLKEISEVERSNKEK
ANSLLSFLGAKIREIREGRKVSSAYSPAASLSPPSYFIDQKK
Download sequence
Identical sequences A3DHI9
203119.Cthe_2216 gi|125974701|ref|YP_001038611.1| gi|385780155|ref|YP_005689320.1| WP_003513622.1.16390 WP_003513622.1.19387 WP_003513622.1.20586 WP_003513622.1.31213 WP_003513622.1.55520 WP_003513622.1.60145 WP_003513622.1.6636 WP_003513622.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]