SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125975321|ref|YP_001039231.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975321|ref|YP_001039231.1|
Domain Number 1 Region: 91-250
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 1.16e-47
Family PA2201 C-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125975321|ref|YP_001039231.1|
Sequence length 412
Comment hypothetical protein Cthe_2839 [Clostridium thermocellum ATCC 27405]
Sequence
MRDPLCSESYLLETIEFDKEEICERKKKIIVLKDDMEKGIQRYPKDNQSIIYATYRGMFM
YNTEILIAKYSLGSHPDEMIEDYLNGIEYLENVGEEKVWYIDLLWMLSLGILLEVDKQDL
KRLACVIEKQKKEDALMDFLLKACDIGWNHNTSEYERKNPYAKTAEIIQMALHDKDREKA
SKRLQQYIEKEWVKGHNDLDFKNAHKEPGYVGLWSFEAAALAKILGLDDSALKDNNHYPY
DLAHYKNGMSFDLSWYGVPVEEEAKEEEAIVYGIPNKPELEQIIPAKFHSFVNEVIGDYN
TLTDEEFWKKYNLREIWFDVKEYEEDNKAKNMLGTIIVFLLVEKEYILQLDYKEDLVDYI
EDIDNYWGKEEVKLISFEVDNDQQYYAYVPKTAAIDSLYEVKLTEVEKIEEV
Download sequence
Identical sequences A3DJA9
WP_020457939.1.31213 gi|125975321|ref|YP_001039231.1| Cth-119 203119.Cthe_2839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]