SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146308243|ref|YP_001188708.1| from Pseudomonas mendocina ymp

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146308243|ref|YP_001188708.1|
Domain Number 1 Region: 433-570
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.45e-37
Family Flavohemoglobin, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 330-428
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.94e-26
Family Ferredoxin reductase FAD-binding domain-like 0.0012
Further Details:      
 
Domain Number 3 Region: 558-669
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.04e-18
Family 2Fe-2S ferredoxin-related 0.022
Further Details:      
 
Domain Number 4 Region: 176-279
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.000000034
Family PNP-oxidase like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146308243|ref|YP_001188708.1|
Sequence length 681
Comment oxidoreductase FAD-binding subunit [Pseudomonas mendocina ymp]
Sequence
MQQLPSHRHSPWHAGEKQLQEKVGVAERMEVLGQKVIRDYMPDQHRDFYRQLPFMIAGAV
DAAGQPWATLIEGEEGFVTSPDPRQLSFDLAAMALDPLDPATSGLHAGDAIGLLGIELHT
RRRNRINGHIRQASAQRLDIDVEHSFGNCPQYIQLRQYRRVHQRGVERLDATGLDARSAE
MIGSADTFFVASYVEHDDGRRSVDVSHRGGRAGFVRVQGNRLTIPDYAGNLHFNTLGNLS
VNPRAGLLFVDFATGDVLQLAGRAEIILDSPLINAFEGAERLWTFDVEQVVLRPAAASLR
WAFEEYAPTSLMTGTWAETDARLREREQRNQWQRWRVQSVQQESSDIRSFVLAPEQGAAP
GFAAGQHLPIRIATASGETLLRTYSLSSAPSDGFLRISVKAQGVVSRHLHGQVRVGDVLE
VRAPLGSFTLNSESRRPLVLIGAGVGITPLLSMLREQVALGQGRRMHFFQGARTLSDLPF
QSELHELVQRAGGLLQVHRALSAPEADAVVGRDYEQQGRIDLAQIKAALSFDDYDFYLCG
PAAFTQAIYDGLRDLNVADERIHAEAFGPSTLTRRTDGQVTTLVQPPAASEPVPVYFSAS
SKEARWTPDSGSLLELAESRGLTPEFSCRGGSCGTCKTRLVSGQVHYPNPPAELPNDGGV
LICCAVPAKGEEGVQPLVLDL
Download sequence
Identical sequences A4XXB0
gi|146308243|ref|YP_001188708.1| 399739.Pmen_3223 WP_012019332.1.24137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]