SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|139473043|ref|YP_001127758.1| from Streptococcus pyogenes str. Manfredo

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|139473043|ref|YP_001127758.1|
Domain Number 1 Region: 5-156
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1e-50
Family Deoxycytidylate deaminase-like 0.0000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|139473043|ref|YP_001127758.1|
Sequence length 157
Comment deaminase [Streptococcus pyogenes str. Manfredo]
Sequence
MPYSLEEQTYFMQEALKEAEKSLQKAEIPIGCVIVKDGEIIGRGHNAREESNQAIMHAEI
MAINEANAHEGNWRLLDTTLFVTIEPCVMCSGAIGLARIPHVIYGASNQKFGGADSLYQI
LTDERLNHRVQVERGLLAADCANIMQTFFRQGRERKK
Download sequence
Identical sequences 160491.SpyM50161 WP_011888571.1.24700 WP_011888571.1.39245 WP_011888571.1.59971 WP_011888571.1.89166 gi|139473043|ref|YP_001127758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]