SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116513627|ref|YP_812533.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116513627|ref|YP_812533.1|
Domain Number 1 Region: 7-82,175-356
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.87e-52
Family Bacterial dinuclear zinc exopeptidases 0.00028
Further Details:      
 
Domain Number 2 Region: 72-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.47e-20
Family Aminopeptidase/glucanase lid domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116513627|ref|YP_812533.1|
Sequence length 361
Comment glutamyl aminopeptidase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
Sequence
MEKAAEIQMLKDFSNANATSGFENEFVDLFTKTVKDYADLEVDGMLNVYASKKQNTGKRP
VIQLDAHSDAVGFLTQAIRPNGLIKFVTLGGWNNVVLPALKVKVRNRDGEYIPGVVALKP
PHFMSEAERTSVPQVADLSIDVGSSSREETINDYKIDTGCPIFVDVDCEYNEKTGLFFGK
DFDDRFGAAAMADILENLKDEEVNFDLVAALSSQEEVGLRGAYVTARKIKPDLCLVLESC
PADDTFEPDWLSQTGLKRGPMLRDMDVTFLPNPKFQQYACDLADKNGIPYTRSVRTGGGQ
DGAAIYYENGAPTIVIGIPVRYEHSPYCFSSYKDYKAAVDLALAIIRDIDKEKLESFKSF
N
Download sequence
Identical sequences A0A0U5K9T9 F0K0E8 G6F519 Q1GBC5
gi|385815240|ref|YP_005851631.1| gi|104773635|ref|YP_618615.1| WP_003618748.1.101236 WP_003618748.1.11778 WP_003618748.1.15974 WP_003618748.1.31115 WP_003618748.1.33988 WP_003618748.1.43242 WP_003618748.1.43743 WP_003618748.1.46396 WP_003618748.1.47362 WP_003618748.1.69250 WP_003618748.1.75338 WP_003618748.1.87012 WP_003618748.1.96184 WP_003618748.1.96615 WP_003618748.1.98317 321956.LBUL_0453 390333.Ldb0512 gi|116513627|ref|YP_812533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]