SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116514364|ref|YP_813270.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116514364|ref|YP_813270.1|
Domain Number 1 Region: 4-202
Classification Level Classification E-value
Superfamily Formyltransferase 7.06e-60
Family Formyltransferase 0.00000493
Further Details:      
 
Domain Number 2 Region: 205-305
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 5.97e-25
Family Post formyltransferase domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116514364|ref|YP_813270.1|
Sequence length 315
Comment methionyl-tRNA formyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
Sequence
MNSVIFLGTPQFGATVLEGLIKAGYHILAVVTQPDKKVGRKQKVVYSPVKEVALANDLPL
YQPVRLSKSDELDELLQLDADFIITAAFGQFLPTKFLKSAKIAAVNVHGSLLPKYRGGAP
IQYAVRNGDAETGVTIMEMVKEMDAGDMYAQASLPIRPDETSGEVFEELAPLGRDLLLET
LPKIASGEIVKKPQDPSQVVFSPTISKAEERISLKLTAKEAKNLIRALNPDPGAYLVIKG
QRLKVWKAEVADDNTSLPAGHLLTNQGRFAISFAGNTVLNLLEVQPNGKKAMAIKDFLNG
QGKKFAAGEKIVDED
Download sequence
Identical sequences A0A0D6ZFT1 F0K378 Q049P0
321956.LBUL_1309 gi|116514364|ref|YP_813270.1| WP_003618469.1.11778 WP_003618469.1.15974 WP_003618469.1.31115 WP_003618469.1.33988 WP_003618469.1.43242 WP_003618469.1.43743 WP_003618469.1.46396 WP_003618469.1.69250 WP_003618469.1.75338 WP_003618469.1.87012 WP_003618469.1.96184 WP_003618469.1.96615 WP_003618469.1.98317 gi|385816026|ref|YP_005852417.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]