SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116514384|ref|YP_813290.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116514384|ref|YP_813290.1|
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Formyltransferase 2.49e-57
Family Formyltransferase 0.0000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116514384|ref|YP_813290.1|
Sequence length 193
Comment folate-dependent phosphoribosylglycinamide formyltransferase PurN [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
Sequence
MKVAIFASGNGTNYEVLAEHFQKGDLPGDLALLFCDHPDAPVIKRAEKFHTPVVTFTVKS
CGGKQKYEEKILRVLKDYQIDFIALAGYMRVIGPTILSEYEGRIVNLHPAYLPAYPGLHS
IERAFADHPAETGVTVHYIDSGLDSGPAIAQRHVPIYDDDTVDTLEARIHECEHHLYPEA
LRKALLKFEEENK
Download sequence
Identical sequences A0A0U5K944 F0K3F0 Q1G9G1
WP_003618420.1.11778 WP_003618420.1.15974 WP_003618420.1.31115 WP_003618420.1.33988 WP_003618420.1.43242 WP_003618420.1.43743 WP_003618420.1.46396 WP_003618420.1.69250 WP_003618420.1.75338 WP_003618420.1.87012 WP_003618420.1.96184 WP_003618420.1.96615 WP_003618420.1.98317 gi|116514384|ref|YP_813290.1| gi|385816052|ref|YP_005852443.1| gi|104774299|ref|YP_619279.1| 321956.LBUL_1332 390333.Ldb1437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]