SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116514565|ref|YP_813471.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116514565|ref|YP_813471.1|
Domain Number 1 Region: 6-225
Classification Level Classification E-value
Superfamily Ribosomal protein L1 8.24e-83
Family Ribosomal protein L1 0.000000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116514565|ref|YP_813471.1|
Sequence length 231
Comment 50S ribosomal protein L1 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
Sequence
MPKHGKKYVEAAKKVDSNKLYSVEDAIKLVKETSYANFDASVEVSYNLSVDPKQADQQIR
GSIVLPNGTGKSVKVIVFAEGPQAEAAKAAGADEVGADDLVEKVQNGYLDFDVVIATPMM
MAKVGRLGRVLGPKGLMPNPKTGTVTMDTAKAVQNVKAGQVEYRVDRQASIHTAIGKVSF
TEEQLTENFRALQNAILRAKPASAKGQYIKSCAVAATFGPGIKLDPIALMA
Download sequence
Identical sequences A0A0U5KAR6 F0JZA2 G6F7C6 Q048T9 Q1G8Z9
WP_003621915.1.101236 WP_003621915.1.11778 WP_003621915.1.15974 WP_003621915.1.17168 WP_003621915.1.31115 WP_003621915.1.33988 WP_003621915.1.43242 WP_003621915.1.43743 WP_003621915.1.46396 WP_003621915.1.47362 WP_003621915.1.69250 WP_003621915.1.75338 WP_003621915.1.87012 WP_003621915.1.96184 WP_003621915.1.96615 WP_003621915.1.98317 gi|104774461|ref|YP_619441.1| 321956.LBUL_1543 390333.Ldb1665 gi|116514565|ref|YP_813471.1| gi|385816237|ref|YP_005852628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]